PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010111631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Trihelix
Protein Properties Length: 414aa    MW: 46840.2 Da    PI: 5.5684
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010111631.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.27e-2675157286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rre++  ++++k++k+lW+++s+kmre+gf rsp++C++kw+nl k++kk +++ + +   +s +++y+++le
  XP_010111631.1  75 WVQEETRSLIGFRREVDGLFNTSKSNKHLWDQISAKMREKGFDRSPTMCTDKWRNLLKEFKKARHQVRVG--SRSAKMSYYEDLE 157
                     *******************************************************************998..45568******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-464135IPR009057Homeodomain-like
PROSITE profilePS500908.30467131IPR017877Myb-like domain
SMARTSM007170.007671133IPR001005SANT/Myb domain
CDDcd122033.13E-2873138No hitNo description
PfamPF138374.2E-1974159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MYCSEKSRPV DFVGGGEEEE SEREMMMEVV SVSANGVLPP HQRAHTQMII LGENNSSGSG  60
EEQEVKAPKK RAETWVQEET RSLIGFRREV DGLFNTSKSN KHLWDQISAK MREKGFDRSP  120
TMCTDKWRNL LKEFKKARHQ VRVGSRSAKM SYYEDLEELL RDRNKHNNSN NSCNNNNNNN  180
NNNSAVAVLG SAYKTPAPPK VDSFIHFSDK GLEDASIPFG PIEASDRSAV NLERRLDHEG  240
DPLAITAADA VVASGVPPWN WRDPPGNGGE SQSSYCGRII TVKLGEYSRR IGIDGTADAI  300
KEVIKSAFRI RTKRAFWLED EDQVVRSLDR DMPLGNYTLH LDEGITIKLC FYDESDRVVV  360
RNEEITLYTE DDFRDFLTRR GFTGLRELSG YRRIDTLDDL QSGAMYQGVR LLGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A2e-4469155186DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010111631.10.0Trihelix transcription factor GT-1
SwissprotQ9FX531e-164TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLW9SWV80.0W9SWV8_9R
STRINGVIT_14s0171g00450.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68173248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-156Trihelix family protein